SARS-CoV-2_M_Protein, GFP/His-tagged

The M or matrix protein is the most abundant protein in the virus and is usually located at the inner layer of the virus envelope. The M protein defines the shape of the virus and contacts the N protein for additional stability.

Overview

Product NameSARS-CoV-2_M_Protein, GFP/His-tagged
Catalog No.P2020-020
RefSeq LinksUniProt P0DTC5
SynonymsMembrane glycoprotein

Sequence Information

SpeciesSARS-CoV-2; Wuhan seafood market pneumonia virus
TagsC-terminal
Sequence with tagsMADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRI
NWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILR
GHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA
LLVQ

Product Information

Expression Hosthuman, HEK293-F (FreeStyle cells)
Formulation20mM Tris, pH 7.5, 300mM NaCl, 0.05% DDM, 0.5% CHS
FormatLiquid, stored and shipped at -80°C
Purity>85% as determined by SDS-PAGE

Background Information

 

One of the most abundant proteins in the severe acute respiratory syndrome corona virus (SARS-CoV) is the matrix (M) protein. It is usually located at the inner layer of the viral envelope membrane and defines the shape of the virus together with the capsid. It establishes the contact between the nucleoprotein (N protein), the envelope protein (E protein) and the viral envelope for additional stability of the virus. Because of its high abundancy in the viral particle, it poses an attractive target for the development of vaccines and drugs against SARS-CoV-2.​

SDS-PAGE analysis

Size exclusion chromatography chromatogram


SDS-PAGE of M Protein
Size exclusion chromatography chromatogram of M Protein

 

Further recombinant SARS-CoV-2 proteins

Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with support on your protein research project. Let us know your questions and requests, our scientific experts will reply shortly.
Get In Contact With Our Scientific Experts





Catalog Protein*

Desired Quantity*


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.