SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag

Recombinant SARS-CoV-2 (COVID-2019) Nucleoprotein (N-protein) from Wuhan pneumonia virus with C-terminal His-Tag.

Overview

Product NameSARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag
Catalog No.P2020-010
RefSeq LinksYP_009724397.2
Synonymscoronavirus NP Protein; 2019-nCoV; coronavirus Nucleocapsid Protein; coronavirus Nucleoprotein Protein; cov np Protein; ncov NP Protein; NCP-CoV Nucleocapsid Protein; novel coronavirus NP Protein; novel coronavirus Nucleocapsid Protein; novel coronavirus Nucleoprotein Protein; np Protein; nucleocapsid Protein; Nucleoprotein Protein

Sequence Information

SpeciesSARS-CoV-2; Wuhan seafood market pneumonia virus
TagsHis-tag, C-terminal
Sequence without tags (AA 1-419)MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG
KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG
LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY
KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQAS

Product Information

Expression HostE. coli
FormulationPBS, pH 7,4
FormatLiquid, stored and shipped at -80°C
Purity> 85% as determined by SDS-PAGE

Background Information

Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phophoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, therefore it is an attractive target for diagnostic purposes.

SDS-PAGE/Coll. Coomassie

Histogram of marked lane in gel picture

SDS-PAGE/Coll.Coomassie of N-Protein, His-TagHistogram (of marked lane in gel picture) of N-Protein,Hist-Tag

 

Further recombinant SARS-CoV-2 proteins

Learn more about our other recombinant SARS-CoV-2 proteins.
Reinhold Horlacher, PhD

Reinhold Horlacher, PhD

Managing Director & CSO

We would be happy to provide you with support on your protein research project. Let us know your questions and requests, our scientific experts will reply shortly.
Get In Contact With Our Scientific Experts





Catalog Protein*

Desired Quantity*


By submitting this form, I consent to trenzyme GmbH receiving and processing my data in order to process my inquiry. My consent is voluntary and I may revoke this consent at any time without providing any reasons, e.g. by sending an email to privacy(at)trenzyme.com with effect for the future. Further notices on data processing can be found in our privacy policy.